LL-37
$0
- CAS No.: 154947-66-7
- Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
- Molecular Weight: 4493,34
- Molecular Formula: C205H340N60O53
- Synonyms: LL-37, ALL-38 peptide, antibacterial peptide LL-37, CAMP protein, cathelicidin-1, [LL-37, 37 aa]
- Research Area: synthetic form of a human antimicrobial peptide, antimicrobial, anti-inflammatory, immunostimulating and potential antineoplastic activities, increases p53 expression, DNA fragmentation, cell cycle arrest, apoptotic cell death in susceptible cancer cells, promotes wound healing.
SKU: N/A
Category: Peptides


