logo-6Glepaglutidelogo-6logo-6
  • HOME
  • ABOUT R&D
  • PEPTIDES
    • TAGS
    • KITS
    • A
      • Ac-Epithalon
      • Ac-Epithalon-NH2
      • Ac-SDKP
      • Ac-Selank
      • Ac-Semax
      • Ac-Semax-NH2
      • Ac-TB4(17-22)
      • Ac-TB4(17-23)
      • Acetyl Carnosine
      • ACE-031
      • Acetyl Tetrapeptide-15
      • Acetyl Tetrapeptide-2
      • Acetyl Tetrapeptide-3
      • Acetyl Tetrapeptide-5
      • Acetyl Tetrapeptide-9
      • Adipotide
      • AHK
      • AHK-Cu
      • ALM201
      • ARA-290
      • Argireline
    • B
      • B7-33
      • Biotin-GHK
      • BMP-2
      • BPC-157
      • Bulevirtide
    • C
      • CaP(H)
      • CaP(S)
      • CaP(V)
      • Carnosine
      • CCK-8(Cholecystokinin-8 Octapeptide)
      • Cilengitide
      • CJC-1295
      • CJC-1295 DAC
    • D
      • Dalargin
      • Davunetide
      • DE-11
      • Dihexa
      • Dipeptide-2
      • DSIP
      • Dulaglutide
    • E
      • Epithalon
      • Epithalon-NH2
      • Epobis
    • F
      • FGL
      • Follistatin 315
      • FOXO4-DRI
    • G
      • GHK
      • GHK-Cu
      • Ghrelin
      • GHRH
      • GHRP-2
      • GHRP-6
      • Glepaglutide
      • Glutathione
      • Gonadorelin
    • H
      • HEP-1
      • Hexapeptide-10
      • Hexapeptide-11
      • Hexapeptide-9
      • Hexarelin
      • HGH frag 176-191
      • Humanin
    • I
      • IGF-1
      • IGF-1 DES
      • IGF-1 LR3
      • Ipamorelin
    • K
      • Kisspeptin-10
      • KPV
    • L
      • Leuphasyl
      • Linaklotide
      • Liraglutide
      • LL-37
      • LZ1
    • M
      • Matrixyl
      • Melanostatin DM
      • Melanotan 1
      • Melanotan 2
      • MGF
      • Motixafortide
      • MOTS-c
      • Myristoyl Pentapeptide-17
    • N
      • Nemifitide
      • Nonapeptide-1
    • O
      • Octreotide
      • Oligopeptide-20
      • OP3-4
      • Oxytocin
    • P
      • P-15
      • P11-4
      • P21
      • Pal-AHK
      • Pal-GHK
      • Palmitoyl Dipeptide-7
      • Palmitoyl Hexapeptide-12
      • Palmitoyl Pentapeptide-4
      • Palmitoyl Tripeptide-38
      • PE 22-28
      • PEG-MGF
      • Pentapeptide-18
      • Pentapeptide-3
      • Pramlintide
      • PT-141
      • PTD-DBM
      • PTP20
    • Q
      • QP3
      • QP5
      • (QPX)3
      • (QPX)5
    • R
      • Rigin
    • S
      • S-Acetyl Glutathione
      • SBP1
      • Selank
      • Semaglutide
      • Semax
      • Semax-NH2
      • Sermorelin
      • Setmelanotide
      • shADP5
      • SNAP-8
      • Spadin
      • SS-31
      • Syn-AKE
      • Syn-Coll
    • T
      • Taltirelin
      • TB-500
      • TB4(17-22)
      • TB4(17-23)
      • TDP
      • Teriparatide
      • Tesamorelin
      • Tetrapeptide-21
      • Thymogen
      • Thymopentin
      • Thymosin alpha 1
      • Thymulin
      • Tirzepatide
      • Tripeptide-10 Citrulline
      • Tripeptide-29
      • Triptorelin
    • V
      • VIP
      • Vosoritide
  • SERVICES
  • PRODUCTS
  • ARTICLES
  • CONTACTS
    • My account
0

$0

✕
            No results See all results
            Zoom

            Glepaglutide

            $0

            • CAS No.: 914009-86-2
            • Sequence: His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Lys-Lys-Lys-Lys-Lys-Lys
            • Molecular Weight: 4535,21
            • Molecular Formula: C201H326N56O61S
            • Synonyms: Glepaglutide, HADGSFSDEMNTILDNLAARDFINWLIQTKITDKKKKKK
            • Research Area: Blood glucose and gastric emptying rate regulator, short bowel syndrome
            Clear
            SKU: N/A Category: Peptides

            ADDRESS

            Peptide Innove Pte. Ltd.
            29 Tuas West Rd, Singapore 638388


            LINKS


            Home
            About us
            Peptides
            Services
            Products
            Articles
            Contact us

            PHONE


            +1(585)300-40 23


            If you have a question,
            please contact at rnd@peptide.one

            © 2026 Betheme by Muffin group | All Rights Reserved | Powered by WordPress
              0

              $0

                        No results See all results
                          ✕

                          Login

                          Lost your password?

                          1. Khavinson, V. K., Izmaylov, D. M., Obukhova, L. K., Malinin, V. V., Effect of epitalon on the lifespan increase in Drosophila melanogaster. Mechanisms of Ageing and Development, 2000. 120(1): p. 141-149. doi: https://doi.org/10.1016/S0047-6374(00)00217-7
                          2. Анисимов, В. Н., Средства профилактики преждевременного старения (геропротекторы). Успехи геронтологии, 2000. 4: p. 275-7.
                          3. Khavinson, V. K., Bondarev, I. E., Butyugov, A. A., Epithalon Peptide Induces Telomerase Activity and Telomere Elongation in Human Somatic Cells.Bulletin of Experimental Biology and Medicine, 2003. 135(6): p. 590-592. doi: 10.1023/A:1025493705728
                          4. Lin’kova, N. S., Drobintseva, A. O., Orlova, O. A., Kuznetsova, E. P., Polyakova, V. O., Kvetnoy, I. M., Khavinson, V. K., Peptide Regulation of Skin Fibroblast Functions during Their Aging In Vitro. Bulletin of Experimental Biology and Medicine, 2016. 161(1): p. 175-178. doi: 10.1007/s10517-016-3370-x
                          5. Khavinson, V. K., Lezhava, T. A., Monaselidze, J. R., Jokhadze, T. A., Dvalishvili, N. A., Bablishvili, N. K., Trofimova, S. V., Peptide Epitalon activates chromatin at the old age. Neuro endocrinology letters, 2003. 24(5): p. 329-333.
                          6. Khavinson, V. K., Kuznik, B. I., Tarnovskaya, S. I., Linkova, N. S., Peptides and CCL11 and HMGB1 as molecular markers of aging: Literature review and own data. Advances in Gerontology, 2015. 5(3): p. 133-140. doi: 10.1134/S2079057015030078
                          7. Vinogradova, I. A., Bukalev, A. V., Zabezhinski, M. A., Semenchenko, A. V., Khavinson, V. K., Anisimov, V. N., Effect of Ala-Glu-Asp-Gly peptide on life span and development of spontaneous tumors in female rats exposed to different illumination regimes. Bulletin of Experimental Biology and Medicine, 2007. 144(6): p. 825-830. doi: 10.1007/s10517-007-0441-z
                          8. Rosenfeld, S. V., Togo, E. F., Mikheev, V. S., Popovich, I. G., Zabezhinskii, M. A., Khavinson, V. K., Anisimov, V. N., Effect of Epithalon on the Incidence of Chromosome Aberrations in Senescence-Accelerated Mice. Bulletin of Experimental Biology and Medicine, 2002. 133(3): p. 274-276. Rosenfeld2002. doi: 10.1023/a:1015899003974
                          9. Anisimov, V. N., Khavinson, V. K., Mikhailova, O. N., Biogerontology in Russia: from past to future. Biogerontology, 2011. 12(1): p. 47-60. doi: 10.1007/s10522-010-9307-2
                          10. Kossoy, G., Anisimov, V. N., Ben-Hur, H., Kossoy, N., Zusman, I., Effect of the Synthetic Pineal Peptide Epitalon on Spontaneous Carcinogenesis in Female C3H/He Mice. In Vivo, 2006. 20(2): p. 253-257.
                          11. Bilski, B., Rzymski, P., Tomczyk, K., Rzymska, I., The impact of factors in work environment (especially shift and night work) on neoplasia of female reproductive organs. Journal of Medical Science, 2016. 84(4): p. 223-228.
                          12. Kozina, L. S., Arutjunyan, A. V., Khavinson, V. K., Antioxidant properties of geroprotective peptides of the pineal gland. Archives of Gerontology and Geriatrics, 2007. 44: p. 213-216. doi: 10.1016/j.archger.2007.01.029
                          13. Pateyk, A. V., Baranchugova, L. M., Rusaeva, N. S., Obydenko, V. I., Kuznik, B. I., Effect of Peptides Lys-Glu-Asp-Gly and Ala-Glu-Asp-Gly on the Morphology of the Thymus in Hypophysectomized Young and Old Birds. Bulletin of Experimental Biology and Medicine, 2013. 154(5): p. 681-685. doi: 10.1007/s10517-013-2029-0
                          14. Линькова, Н. С., Кузник, Б. И., Хавинсон, В. Х., Пептид Ala-Glu-Asp-Gly и интерферон гамма: роль в иммунном ответе при старении. Успехи геронтологии, 2012. 25(3): p. 478-482.
                          15. Коркушко, О. В., Лапин, Б. А., Гончарова, Н. Д., Хавинсон, В. Х., Шатило, В. Б., Венгерин, А. А., Антонюк-Щеглова, И. А., Магдич, Л. В., Нормализующее влияние пептидов эпифиза на суточный ритм мелатонина у старых обезьян и людей пожилого возраста. Успехи геронтологии, 2007. 20(1): p. 74-85.
                          16. Korenevsky, A., Milyutina, Y., Kozina, L., Arutjunyan, A., Role of Reactive Oxygen Species in Premature Ageing of the Female Reproductive Function.Current aging science, 2016. 09. doi: 10.2174/1874609809666161006111645
                          17. Khavinson, V., Razumovsky, M., Trofimova, S., Grigorian, R., Razumovskaya, A., Pineal-regulating tetrapeptide epitalon improves eye retina condition in retinitis pigmentosa. Neuroendocrinology Letters, 2002. 23(4): p. 365-369.
                          18. Dzhokhadze, T. A., Buadze, T., Rubanov, K. D., Kiriia, N. A., Lezhava, T. A., [Genome instability in pulmonary tuberculosis before and after treatment].Georgian medical news, 2013(224): p. 77-81.
                          19. Lezhava, T., Buadze, T., Jokhadze, T., Monaselidze, J., Gaiozishvili, M., Rubanovi, K., Kiria, N., Normalization of Epigenetic Change in the Genome by Peptide Bioregulator (Ala–Glu–Asp–Gly) in Pulmonary Tuberculosis. International Journal of Peptide Research and Therapeutics, 2019. 25(2): p. 555-563. doi: 10.1007/s10989-018-9699-4